Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polaromonas sp. UPF0391 membrane protein Bpro_0066 (Bpro_0066)

This Recombinant Polaromonas sp. UPF0391 membrane protein Bpro_0066 (Bpro_0066) spans the amino acid sequence from region 1-61.

Product Specifications

Product Name Alternative

UPF0391 membrane protein Bpro_0066

UniProt

Q12HF9

Expression Region

1-61

Origin

Polaromonas sp. (strain JS666 / ATCC BAA-500)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKYAIIFAVISLIAGALGFGGVAAGAAGIAKILFGLFLILAVIFVVLAALGVGAVRKGM K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL
BNC680429-500 1x 500 µL

CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF405S conjugate, 0.1mg/mL
BNC042222-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF740 conjugate, 0.1mg/mL
BNC742085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF640R conjugate, 0.1mg/mL
BNC401975-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details