Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C27E2.11c, mitochondrial (SPAC27E2.11c)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C27E2.11c, mitochondrial (SPAC27E2.11c) spans the amino acid sequence from region 21-81.

Product Specifications

Product Name Alternative

Uncharacterized protein C27E2.11c, mitochondrial

UniProt

Q9UTA0

Expression Region

21-81

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ANSTAPYGNTTNSTGTTNGTNGTNTTTSSTATQSSAASITNFSSGAFVIAMIAVACSVMS L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF568 conjugate, 0.1mg/mL
BNC682618-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF647 conjugate, 0.1mg/mL
BNC472278-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details