Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 7 Glycoprotein N (U46)

This Recombinant Human herpesvirus 7 Glycoprotein N (U46) spans the amino acid sequence from region 25-86.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P52366

Expression Region

25-86

Origin

Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NEVDGEELFYKPTCHSDTYEIILKKFSSIWILVNTFILLCSFSLFLKYWCFKTLAKETVK GY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRK Antibody
KC-6130-01 50 μL

CRK Antibody

Sign In for Pricing
View Details
CRK Antibody
KC-6130-02 100 µL

CRK Antibody

Sign In for Pricing
View Details
CRK Antibody
KC-6130-03 1 mL

CRK Antibody

Sign In for Pricing
View Details
NUP107 (Center) Rabbit Polyclonal Antibody
AP52969PU-N 400 µL

NUP107 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504665 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
DCTN2 Antibody
KC-3197-01 50 μL

DCTN2 Antibody

Sign In for Pricing
View Details