Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 7 Glycoprotein N (U46)

This Recombinant Human herpesvirus 7 Glycoprotein N (U46) spans the amino acid sequence from region 25-86.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P52366

Expression Region

25-86

Origin

Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NEVDGEELFYKPTCHSDTYEIILKKFSSIWILVNTFILLCSFSLFLKYWCFKTLAKETVK GY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(Pentyl-d11)-3-(4-ethyl-naphthoyl)indole
TRC-P279902-50MG 50 mg

1-(Pentyl-d11)-3-(4-ethyl-naphthoyl)indole

Sign In for Pricing
View Details
Human ZNF431 activation kit by CRISPRa
GA116230 1 Kit

Human ZNF431 activation kit by CRISPRa

Sign In for Pricing
View Details
Tryptamine-d4 Hydrochloride
TRC-T894602-25MG 25 mg

Tryptamine-d4 Hydrochloride

Sign In for Pricing
View Details
Human SPACA3 activation kit by CRISPRa
GA114867 1 Kit

Human SPACA3 activation kit by CRISPRa

Sign In for Pricing
View Details
VMP1 Antibody
KC-852-01 50 μL

VMP1 Antibody

Sign In for Pricing
View Details
VMP1 Antibody
KC-852-02 100 µL

VMP1 Antibody

Sign In for Pricing
View Details