Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 7 Glycoprotein N (U46)

This Recombinant Human herpesvirus 7 Glycoprotein N (U46) spans the amino acid sequence from region 25-86.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P52366

Expression Region

25-86

Origin

Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NEVDGEELFYKPTCHSDTYEIILKKFSSIWILVNTFILLCSFSLFLKYWCFKTLAKETVK GY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cetn1 (NM_007593) Mouse Tagged ORF Clone
MG201460 10 µg

Cetn1 (NM_007593) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein
TP310159M 100 µg

Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein

Sign In for Pricing
View Details
EP4 (PTGER4) (NM_000958) Human Recombinant Protein
TP310932 20 µg

EP4 (PTGER4) (NM_000958) Human Recombinant Protein

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL
BNCB2054-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL
BNC680413-100 1x 100 µL

Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), 1mg/mL
BNUM1683-50 1x 50 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), 1mg/mL

Sign In for Pricing
View Details