Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ylaF (ylaF)

This Recombinant Bacillus subtilis Uncharacterized protein ylaF (ylaF) spans the amino acid sequence from region 1-62.

Product Specifications

Product Name Alternative

Uncharacterized protein ylaF

UniProt

O07630

Expression Region

1-62

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKMNWLLLLFAFAAVFSIMLIGVFIAEKSPAGIIASIVLVCAVMGGGFTLKKKMREQGL LD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAALADL1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1385504 1.0 µg DNA

NAALADL1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
STAP1 (Signal-transducing Adaptor Protein 1, STAP-1, BCR Downstream-signaling Protein 1, BRDG1, Docking Protein BRDG1, Stem Cell Adaptor Protein 1) (PE)
MBS6395234-01 0.1 mL

STAP1 (Signal-transducing Adaptor Protein 1, STAP-1, BCR Downstream-signaling Protein 1, BRDG1, Docking Protein BRDG1, Stem Cell Adaptor Protein 1) (PE)

Sign In for Pricing
View Details
STAP1 (Signal-transducing Adaptor Protein 1, STAP-1, BCR Downstream-signaling Protein 1, BRDG1, Docking Protein BRDG1, Stem Cell Adaptor Protein 1) (PE)
MBS6395234-02 5x 0.1 mL

STAP1 (Signal-transducing Adaptor Protein 1, STAP-1, BCR Downstream-signaling Protein 1, BRDG1, Docking Protein BRDG1, Stem Cell Adaptor Protein 1) (PE)

Sign In for Pricing
View Details
Poly-L-lysine Coated - 96 well Solid plates - Black PS
MCB12F-LYS-L 10x 96 Well Plates

Poly-L-lysine Coated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details
Anti-LIV-1 / SLC39A6 Reference Antibody (ladiratuzumab vedotin)
E24CHB250 100 µg

Anti-LIV-1 / SLC39A6 Reference Antibody (ladiratuzumab vedotin)

Sign In for Pricing
View Details
DHRSX (NM_145177) Human Mass Spec Standard
PH307107 10 µg

DHRSX (NM_145177) Human Mass Spec Standard

Sign In for Pricing
View Details