Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II reaction center protein Z (psbZ)

This Recombinant Photosystem II reaction center protein Z (psbZ) spans the amino acid sequence from region 1-62.

Product Specifications

Product Name Alternative

Photosystem II reaction center protein Z, PSII-Z

UniProt

Q1KVS7

Expression Region

1-62

Origin

Scenedesmus obliquus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSVLQIALLALIAVSFALVVGVPVVFATPNGWSENKGIVFSGLSLWLVLVFAVGIFNSF VI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1042), CF640R conjugate, 0.1mg/mL
BNC401042-100 1x 100 µL

TRIM29 (TRIM29/1042), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF740 conjugate, 0.1mg/mL
BNC740705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF568 conjugate, 0.1mg/mL
BNC681731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF568 conjugate, 0.1mg/mL
BNC681422-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF647 conjugate, 0.1mg/mL
BNC472409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details