Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II reaction center protein Z (psbZ)

This Recombinant Photosystem II reaction center protein Z (psbZ) spans the amino acid sequence from region 1-62.

Product Specifications

Product Name Alternative

Photosystem II reaction center protein Z, PSII-Z

UniProt

Q70Y06

Expression Region

1-62

Origin

Amborella trichopoda

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAFQLAVFALIATSSILLISVPVVFASSDGWSSNKNIVFSGTSLWIGLVFLVAILNSL IS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details