Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Negative regulatory protein yxlE (yxlE)

This Recombinant Bacillus subtilis Negative regulatory protein yxlE (yxlE) spans the amino acid sequence from region 1-62.

Product Specifications

Product Name Alternative

Negative regulatory protein yxlE

UniProt

P94373

Expression Region

1-62

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNISWEMILPLIVLQLALAVFALISCIKEERTNGPKWMWAAIIVCINIIGPILFFTVGRK QR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)
abx344702-01 50 µL

ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)

Sign In for Pricing
View Details
ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)
abx344702-02 100 µL

ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)

Sign In for Pricing
View Details
ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)
abx344702-03 200 µL

ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)

Sign In for Pricing
View Details
ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)
abx344702-04 1 mL

ER membrane protein complex subunit 4 (EMC4) Antibody (FITC)

Sign In for Pricing
View Details
Polvitolimod
orb1689158-01 25 mg

Polvitolimod

Sign In for Pricing
View Details
Polvitolimod
orb1689158-02 50 mg

Polvitolimod

Sign In for Pricing
View Details