Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C17orf110 (C17orf110)

This Recombinant Human Putative uncharacterized protein C17orf110 (C17orf110) spans the amino acid sequence from region 1-62.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C17orf110

UniProt

P0DI80

Expression Region

1-62

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGE EE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein H (APOH) (NM_000042) Human Recombinant Protein
TP720364M 50 µg

Apolipoprotein H (APOH) (NM_000042) Human Recombinant Protein

Sign In for Pricing
View Details
EGFR Mouse Monoclonal Antibody [Clone ID: GFR450]
AM32821PU-T 20 µg

EGFR Mouse Monoclonal Antibody [Clone ID: GFR450]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Brain
CB530186 1 Block

Frozen Tissue Blocks, Brain

Sign In for Pricing
View Details
5α-Pregnane-3β,20α-diol Disulfate Sodium
TRC-P893780-50MG 50 mg

5α-Pregnane-3β,20α-diol Disulfate Sodium

Sign In for Pricing
View Details
GRK4 Mouse Monoclonal Antibody [Clone ID: OTI9A3]
CF806069 100 µg

GRK4 Mouse Monoclonal Antibody [Clone ID: OTI9A3]

Sign In for Pricing
View Details
2-Amino-5-(aminosulfonyl)-4-chlorobenzamide
TRC-A629465-25MG 25 mg

2-Amino-5-(aminosulfonyl)-4-chlorobenzamide

Sign In for Pricing
View Details