Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yfgG (yfgG)

This Recombinant Uncharacterized protein yfgG (yfgG) spans the amino acid sequence from region 1-63.

Product Specifications

Product Name Alternative

Uncharacterized protein yfgG

UniProt

P64546

Expression Region

1-63

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQATSMRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESP VQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amylin (8-37)(human)
MBS5818403 Inquire

Amylin (8-37)(human)

Sign In for Pricing
View Details
1- (2-chloro-5- (trifluoromethyl) phenyl) -2,2-difluoropropan-1-one
PC1014462-01 250 mg

1- (2-chloro-5- (trifluoromethyl) phenyl) -2,2-difluoropropan-1-one

Sign In for Pricing
View Details
1- (2-chloro-5- (trifluoromethyl) phenyl) -2,2-difluoropropan-1-one
PC1014462-02 1 g

1- (2-chloro-5- (trifluoromethyl) phenyl) -2,2-difluoropropan-1-one

Sign In for Pricing
View Details
NCALD (NM_032041) Human Tagged ORF Clone Lentiviral Particle
RC214659L3V 200 µL

NCALD (NM_032041) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FSTL1 Antibody
36488 100 µL

FSTL1 Antibody

Sign In for Pricing
View Details
CCDC144NL ORF Vector (Human) (pORF)
ORF001963 1.0 µg DNA

CCDC144NL ORF Vector (Human) (pORF)

Sign In for Pricing
View Details