Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yszA (yszA)

This Recombinant Uncharacterized membrane protein yszA (yszA) spans the amino acid sequence from region 1-63.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yszA

UniProt

C0H465

Expression Region

1-63

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKRFSSYSLPPWVRQIRLVSAQVIIPITIFQGIRTIFFPTTFDVLLLAILIFLACALHL EWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpastatin (CAST/1550), Biotin conjugate, 0.1mg/mL
BNCB1550-500 1x 500 µL

Calpastatin (CAST/1550), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat IL-1 alpha/IL1A, Tag Free
HA211058-01 Inquire

Rat IL-1 alpha/IL1A, Tag Free

Sign In for Pricing
View Details
Rat IL-1 alpha/IL1A, Tag Free
HA211058-02 50 µg

Rat IL-1 alpha/IL1A, Tag Free

Sign In for Pricing
View Details
Rat IL-1 alpha/IL1A, Tag Free
HA211058-03 100 µg

Rat IL-1 alpha/IL1A, Tag Free

Sign In for Pricing
View Details
STK16 (NM_001008910) Human Recombinant Protein
TP319087M 100 µg

STK16 (NM_001008910) Human Recombinant Protein

Sign In for Pricing
View Details
TRIM17 (NM_001024940) Human Over-expression Lysate
LY422560 100 µg

TRIM17 (NM_001024940) Human Over-expression Lysate

Sign In for Pricing
View Details