Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yhzF (yhzF)

This Recombinant Uncharacterized membrane protein yhzF (yhzF) spans the amino acid sequence from region 1-63.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yhzF

UniProt

C0H3Y3

Expression Region

1-63

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTK LLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHB16 Human siRNA Oligo Duplex (Locus ID 57717)
SR311686 1 Kit

PCDHB16 Human siRNA Oligo Duplex (Locus ID 57717)

Sign In for Pricing
View Details
RMND1 (h) -PR
sc-95226-PR 10 µM - 20 µL

RMND1 (h) -PR

Sign In for Pricing
View Details
Fam109a sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3613004 1.0 µg DNA

Fam109a sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii Mvan_5528 Protein (aa 1-110)
VAng-Yyj5281-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Vanbaalenii Mvan_5528 Protein (aa 1-110)

Sign In for Pricing
View Details
Human RNA-Binding Protein NOB1 (NOB1) Antibody
35752-05111 150 µg

Human RNA-Binding Protein NOB1 (NOB1) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pde6c shRNA (UAS) - Lentiviral mouse Pde6c shRNA (UAS) (25)
GTR15189965 1 Vial

Lentiviral mouse Pde6c shRNA (UAS) - Lentiviral mouse Pde6c shRNA (UAS) (25)

Sign In for Pricing
View Details