Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yhzF (yhzF)

This Recombinant Uncharacterized membrane protein yhzF (yhzF) spans the amino acid sequence from region 1-63.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yhzF

UniProt

C0H3Y3

Expression Region

1-63

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTK LLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN8 Antibody
A74395-100UL 100 µL

CLDN8 Antibody

Sign In for Pricing
View Details
Transferrin Receptor (CD71, TR, Tfr, TfnrR) (MaxLight 650) discontinued
T8199-30F-ML650 100 µL

Transferrin Receptor (CD71, TR, Tfr, TfnrR) (MaxLight 650) discontinued

Sign In for Pricing
View Details
GNB1 (Guanine Nucleotide-Binding Protein G (I) /G (S) /G (T) Subunit Beta-1, Guanine Nucleotide Binding Protein (G Protein), Beta Polypeptide 1)
481979 100 µL

GNB1 (Guanine Nucleotide-Binding Protein G (I) /G (S) /G (T) Subunit Beta-1, Guanine Nucleotide Binding Protein (G Protein), Beta Polypeptide 1)

Sign In for Pricing
View Details
Mouse Monoclonal RFXANK Antibody (4G10)
H00008625-M01 0.1 mg

Mouse Monoclonal RFXANK Antibody (4G10)

Sign In for Pricing
View Details
IL12B / IL12p40 Immunizing Peptide
orb17262 100 µg

IL12B / IL12p40 Immunizing Peptide

Sign In for Pricing
View Details
Enpep (NM_007934) Mouse Recombinant Protein
E45M44294M5 20 µg

Enpep (NM_007934) Mouse Recombinant Protein

Sign In for Pricing
View Details