Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypmT (ypmT)

This Recombinant Bacillus subtilis Uncharacterized protein ypmT (ypmT) spans the amino acid sequence from region 1-64.

Product Specifications

Product Name Alternative

Uncharacterized protein ypmT

UniProt

P54180

Expression Region

1-64

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIYQYFSLLSFTFSLYFGWLAYHHLAAEDMDQMYLNVSYCALFLSVMVFTFGMRDRKK TDKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Chloride 0.9% Solution
EC-901 1 L

Sodium Chloride 0.9% Solution

Sign In for Pricing
View Details
Pizotifen Malate
TRC-P552803-50MG 50 mg

Pizotifen Malate

Sign In for Pricing
View Details
AREG Antibody
KC-3685-01 50 μL

AREG Antibody

Sign In for Pricing
View Details
AREG Antibody
KC-3685-02 100 µL

AREG Antibody

Sign In for Pricing
View Details
AREG Antibody
KC-3685-03 1 mL

AREG Antibody

Sign In for Pricing
View Details
NOX2 / gp91phox Recombinant Rabbit monoclonal Antibody
HA723224 100 µL

NOX2 / gp91phox Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details