Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypmT (ypmT)

This Recombinant Bacillus subtilis Uncharacterized protein ypmT (ypmT) spans the amino acid sequence from region 1-64.

Product Specifications

Product Name Alternative

Uncharacterized protein ypmT

UniProt

P54180

Expression Region

1-64

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIYQYFSLLSFTFSLYFGWLAYHHLAAEDMDQMYLNVSYCALFLSVMVFTFGMRDRKK TDKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Profilin-2/PFN2 Protein
PKSH032935-01 10 µg

Recombinant Human Profilin-2/PFN2 Protein

Sign In for Pricing
View Details
Recombinant Human Profilin-2/PFN2 Protein
PKSH032935-02 50 µg

Recombinant Human Profilin-2/PFN2 Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502990 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant Mouse IL-31 protein (N-His)
PKSM041477-01 20 µg

Recombinant Mouse IL-31 protein (N-His)

Sign In for Pricing
View Details
Recombinant Mouse IL-31 protein (N-His)
PKSM041477-02 100 µg

Recombinant Mouse IL-31 protein (N-His)

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/451), CF568 conjugate, 0.1mg/mL
BNC680451-100 1x 100 µL

HER-2 / CD340 (HRB2/451), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details