Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem II reaction center protein J (psbJ)

This Recombinant Prochlorococcus marinus Photosystem II reaction center protein J (psbJ) spans the amino acid sequence from region 1-64.

Product Specifications

Product Name Alternative

Photosystem II reaction center protein J, PSII-J

UniProt

A2BUT1

Expression Region

1-64

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLKGPDGRIPDRLPDGRPAVAWERRWTEGTLPLWLVATAGGIAVIFVLGIFFYGSYQG VGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-100 1x 100 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF640R conjugate, 0.1mg/mL
BNC402409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details