Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein US34A (US34A)

This Recombinant Human cytomegalovirus Uncharacterized protein US34A (US34A) spans the amino acid sequence from region 1-64.

Product Specifications

Product Name Alternative

Uncharacterized protein US34A

UniProt

Q6SVX3

Expression Region

1-64

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKFFLKLRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAHLRRYEERLQKNRARRR QSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr17 3'UTR Luciferase Stable Cell Line
TU205352 1.0 mL

Gpr17 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NRF1 (NM_005011) Human Tagged ORF Clone Lentiviral Particle
RC220113L4V 200 µL

NRF1 (NM_005011) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human NKG2A & CD94 Heterodimer
BP001-10ug 10 µg

Recombinant Human NKG2A & CD94 Heterodimer

Sign In for Pricing
View Details
SAMD5 CRISPRa sgRNA lentivector (set of three targets)(Rat)
43000126 3x 1.0µg DNA

SAMD5 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human PKLR Recombinant Protein
PPT-14586 100 µg

Human PKLR Recombinant Protein

Sign In for Pricing
View Details
DAZAP2 (NM_001136267) Human 3' UTR Clone
SC214880 10 µg

DAZAP2 (NM_001136267) Human 3' UTR Clone

Sign In for Pricing
View Details