Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein US34A (US34A)

This Recombinant Human cytomegalovirus Uncharacterized protein US34A (US34A) spans the amino acid sequence from region 1-64.

Product Specifications

Product Name Alternative

Uncharacterized protein US34A

UniProt

Q7M6G6

Expression Region

1-64

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKFLLKFRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAHLRRYEERLRKNRARRR QSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cytokeratin-19 Antibody
RC-5215-01 50 μL

Recombinant Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-19 Antibody
RC-5215-02 100 µL

Recombinant Cytokeratin-19 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-19 Antibody
RC-5215-03 1 mL

Recombinant Cytokeratin-19 Antibody

Sign In for Pricing
View Details
CCDC134-set siRNA/shRNA/RNAi Lentivector (Human)
15197091 4x 500 ng

CCDC134-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
VWF (Von Willebrand Factor, F8VWF, VWD) (MaxLight 490)
MBS6398442-01 0.1 mL

VWF (Von Willebrand Factor, F8VWF, VWD) (MaxLight 490)

Sign In for Pricing
View Details
VWF (Von Willebrand Factor, F8VWF, VWD) (MaxLight 490)
MBS6398442-02 5x 0.1 mL

VWF (Von Willebrand Factor, F8VWF, VWD) (MaxLight 490)

Sign In for Pricing
View Details