Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yjeT (yjeT)

This Recombinant Escherichia coli Uncharacterized protein yjeT (yjeT) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized protein yjeT

UniProt

P0AF73

Expression Region

1-65

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Involucrin (SY5), CF640R conjugate, 0.1mg/mL
BNC400678-500 1x 500 µL

Involucrin (SY5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CX3CR1 Rabbit Polyclonal Antibody
TA371777 100 µL

CX3CR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAF6 (NM_145803) Human Over-expression Lysate
LC403440 20 µg

TRAF6 (NM_145803) Human Over-expression Lysate

Sign In for Pricing
View Details
NIT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H7]
TA501081BM 100 µL

NIT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H7]

Sign In for Pricing
View Details
Tgm5 Mouse Gene Knockout Kit (CRISPR)
KN517499 1 Kit

Tgm5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP60 Recombinant Rabbit monoclonal Antibody
HA750175 100 µL

HSP60 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details