Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yjeT (yjeT)

This Recombinant Escherichia coli Uncharacterized protein yjeT (yjeT) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized protein yjeT

UniProt

P0AF73

Expression Region

1-65

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
Frataxin (Mitochondrial Marker) (rFXN/2124), CF640R conjugate, 0.1mg/mL
BNC403794-100 1x 100 µL

Frataxin (Mitochondrial Marker) (rFXN/2124), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: right upper lobe
CS803039 5x 5 µm

Tissue FFPE Sections, Lung: right upper lobe

Sign In for Pricing
View Details
2-Bromopentanedioic Acid
TRC-B740018-1G 1 g

2-Bromopentanedioic Acid

Sign In for Pricing
View Details
SMNDC1 (NM_005871) Human Recombinant Protein
TP303791 20 µg

SMNDC1 (NM_005871) Human Recombinant Protein

Sign In for Pricing
View Details