Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yjeT (yjeT)

This Recombinant Escherichia coli Uncharacterized protein yjeT (yjeT) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized protein yjeT

UniProt

P0AF73

Expression Region

1-65

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r78 Mouse Gene Knockout Kit (CRISPR)
KN519094 1 Kit

Vmn1r78 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS643562 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
KCNC4 Human qPCR Primer Pair (NM_004978)
HP232476 200 Reactions

KCNC4 Human qPCR Primer Pair (NM_004978)

Sign In for Pricing
View Details
SLC39A12 (NM_001145195) Human Over-expression Lysate
LY428745 100 µg

SLC39A12 (NM_001145195) Human Over-expression Lysate

Sign In for Pricing
View Details
FKBP38 (FKBP8) Rabbit Monoclonal Antibody
TA423956 100 µL

FKBP38 (FKBP8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Scopoletin-13C,d3
TRC-S200502-10MG 10 mg

Scopoletin-13C,d3

Sign In for Pricing
View Details