Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yjeT (yjeT)

This Recombinant Uncharacterized protein yjeT (yjeT) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized protein yjeT

UniProt

P0AF75

Expression Region

1-65

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vascular Endothelial Growth Factor A (VEGFA)
SIPA087Ca01-01 10 µg

Recombinant Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor A (VEGFA)
SIPA087Ca01-02 50 µg

Recombinant Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor A (VEGFA)
SIPA087Ca01-03 200 µg

Recombinant Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor A (VEGFA)
SIPA087Ca01-04 1 mg

Recombinant Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor A (VEGFA)
SIPA087Ca01-05 5 mg

Recombinant Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
GGCX Human qPCR Template Standard (NM_000821)
HK203331 1 Kit

GGCX Human qPCR Template Standard (NM_000821)

Sign In for Pricing
View Details