Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yjeT (yjeT)

This Recombinant Uncharacterized protein yjeT (yjeT) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized protein yjeT

UniProt

P0AF75

Expression Region

1-65

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A/H2A.1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3779R-BF750 100 µL

Histone H2A/H2A.1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
ELISA Kit For Experimental autoimmune prostatitis antigen 2
E8831m 96 Tests

ELISA Kit For Experimental autoimmune prostatitis antigen 2

Sign In for Pricing
View Details
HIST1H2BL CRISPR Knock Out 293T Cell Line (Human)
23346141 1x 10^6 Cells / 1.0 mL

HIST1H2BL CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
GPR124 (ADGRA2) (NM_032777) Human Tagged ORF Clone
RC229431 10 µg

GPR124 (ADGRA2) (NM_032777) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tiglyl glycine
sc-213046 100 mg

Tiglyl glycine

Sign In for Pricing
View Details
B7H4 Polyclonal Antibody, PE Conjugated
bs-0673R-PE 100 µL

B7H4 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details