Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yjeT (yjeT)

This Recombinant Uncharacterized protein yjeT (yjeT) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized protein yjeT

UniProt

P0AF74

Expression Region

1-65

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLNS1A Human shRNA Plasmid Kit (Locus ID 1207)
TL313848 1 Kit

CLNS1A Human shRNA Plasmid Kit (Locus ID 1207)

Sign In for Pricing
View Details
EPHA5 Peptide - middle region
MBS3238839-01 0.1 mg

EPHA5 Peptide - middle region

Sign In for Pricing
View Details
EPHA5 Peptide - middle region
MBS3238839-02 5x 0.1 mg

EPHA5 Peptide - middle region

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to Cytokeratin(Pan)
MAB-606020335 0.1ml

Mouse Monoclonal Antibody to Cytokeratin(Pan)

Sign In for Pricing
View Details
Nectin4, His-Avi-Tag, Biotin-labeled
100675-2 50 µg

Nectin4, His-Avi-Tag, Biotin-labeled

Sign In for Pricing
View Details
Annexin A2 Antibody / ANXA2
F54307-0.4ML 0.4 mL

Annexin A2 Antibody / ANXA2

Sign In for Pricing
View Details