Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ytcA (ytcA)

This Recombinant Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

A1AIS9

Expression Region

27-91

Origin

Escherichia coli O1:K1 / APEC

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPGWFFCAIASLILTLITRRIIQRTNINLAFVGIIYTALFALYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS23P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV784054 1.0 µg DNA

RPS23P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TMLHE (NM_018196) Human Over-expression Lysate
LS055217-20ug 20 µg

TMLHE (NM_018196) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)
MBS1293334-01 0.02 mg (E-Coli)

Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)
MBS1293334-02 0.02 mg (Yeast)

Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)
MBS1293334-03 0.1 mg (E-Coli)

Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)

Sign In for Pricing
View Details
Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)
MBS1293334-04 0.1 mg (Yeast)

Recombinant Cupriavidus pinatubonensis Glutamate racemase (murI)

Sign In for Pricing
View Details