Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ytcA (ytcA)

This Recombinant Escherichia coli Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

A5A630

Expression Region

27-91

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPSWFFCAIASLILTLITRRVIQRANINLAFVGIIYTALFALYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF7L2 Protein Vector (Human) (pPM-C-His)
PV135201 500 ng

TCF7L2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
REXO1L3P sgRNA CRISPR Lentivector (Human) (Target 2)
K1810503 1.0 µg DNA

REXO1L3P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit
MBS3805959-01 48 Well

Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit

Sign In for Pricing
View Details
Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit
MBS3805959-02 96 Well

Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit

Sign In for Pricing
View Details
Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit
MBS3805959-03 5x 96 Well

Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit

Sign In for Pricing
View Details
Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit
MBS3805959-04 10x 96 Well

Mouse Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit

Sign In for Pricing
View Details