Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ytcA (ytcA)

This Recombinant Escherichia coli Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q1R3H8

Expression Region

27-91

Origin

Escherichia coli (strain UTI89 / UPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPGWFFCAIASLILTLITRRIIQRTNINLAFVGIIYTALFALYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 Mouse Monoclonal Antibody [Clone ID: OTI4H4]
CF811519 100 µg

CD14 Mouse Monoclonal Antibody [Clone ID: OTI4H4]

Sign In for Pricing
View Details
CD94 (KLRD1) Mouse Monoclonal Antibody [Clone ID: DX22]
AM05552PU-L 200 µg

CD94 (KLRD1) Mouse Monoclonal Antibody [Clone ID: DX22]

Sign In for Pricing
View Details
EWSR1 Mouse Monoclonal Antibody [Clone ID: OTI2G3]
CF813055 100 µg

EWSR1 Mouse Monoclonal Antibody [Clone ID: OTI2G3]

Sign In for Pricing
View Details
Digoxigenin Tyramide
TRC-D446511-1MG 1 mg

Digoxigenin Tyramide

Sign In for Pricing
View Details
Screen Quest™ Membrane Potential Assay Kit *Orange Fluorescence*
35999-AAT 1 Plate

Screen Quest™ Membrane Potential Assay Kit *Orange Fluorescence*

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), Biotin conjugate, 0.1mg/mL
BNCB2290-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details