Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ytcA (ytcA)

This Recombinant Escherichia coli Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q1R3H8

Expression Region

27-91

Origin

Escherichia coli (strain UTI89 / UPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPGWFFCAIASLILTLITRRIIQRTNINLAFVGIIYTALFALYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF594 conjugate, 0.1mg/mL
BNC942983-100 1x 100 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bid Rabbit Polyclonal Antibody
AP11300PU-N 400 µL

Bid Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD105 Antibody[SN6h]
AN003640P-01 25 µg

Purified Anti-Human CD105 Antibody[SN6h]

Sign In for Pricing
View Details
Purified Anti-Human CD105 Antibody[SN6h]
AN003640P-02 100 µg

Purified Anti-Human CD105 Antibody[SN6h]

Sign In for Pricing
View Details
Apolipoprotein A I (APOA1) (NM_000039) Human Over-expression Lysate
LC400009 20 µg

Apolipoprotein A I (APOA1) (NM_000039) Human Over-expression Lysate

Sign In for Pricing
View Details
SFT2D3 Antibody
8C19500-AAT 50 µg

SFT2D3 Antibody

Sign In for Pricing
View Details