Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA)

This Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q31TR5

Expression Region

27-91

Origin

Shigella boydii serotype 4 (strain Sb227)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPSWFFCAIASLILTLITRRIIQRANINLAFVGIIYTALFAVYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIRAP Polyclonal Antibody, Cy3 Conjugated
bs-7561R-Cy3 100 µL

TIRAP Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
RAB21 Mouse Monoclonal Antibody [Clone ID: OTI4A6]
TA505741S 30 µL

RAB21 Mouse Monoclonal Antibody [Clone ID: OTI4A6]

Sign In for Pricing
View Details
Gm5868 (NM_001024147) Mouse Tagged Lenti ORF Clone
MR212340L3 10 µg

Gm5868 (NM_001024147) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZnT-1 Double Nickase Plasmid (h)
sc-403094-NIC 20 µg

ZnT-1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
SLC16A6 Rabbit Polyclonal Antibody
orb3072406-01 30 µL

SLC16A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC16A6 Rabbit Polyclonal Antibody
orb3072406-02 50 µL

SLC16A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details