Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA)

This Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q31TR5

Expression Region

27-91

Origin

Shigella boydii serotype 4 (strain Sb227)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPSWFFCAIASLILTLITRRIIQRANINLAFVGIIYTALFAVYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IFNAR1 (Ser535+Ser539) Polyclonal Antibody
bs-5457R 100 µL

Phospho-IFNAR1 (Ser535+Ser539) Polyclonal Antibody

Sign In for Pricing
View Details
Aluminum Weighing Dishes, 45
1464258 50 PK

Aluminum Weighing Dishes, 45

Sign In for Pricing
View Details
Rabbit Polyclonal NLRX1 Antibody
NBP2-27198SS 0.025 mg

Rabbit Polyclonal NLRX1 Antibody

Sign In for Pricing
View Details
Rabbit anti-SPARC Antibody
YLD7345-01 50 µL

Rabbit anti-SPARC Antibody

Sign In for Pricing
View Details
Rabbit anti-SPARC Antibody
YLD7345-02 100 µL

Rabbit anti-SPARC Antibody

Sign In for Pricing
View Details
MIA40 Antibody - C-terminal region
OAAB07775-400UL 400 µL

MIA40 Antibody - C-terminal region

Sign In for Pricing
View Details