Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA)

This Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q31TR5

Expression Region

27-91

Origin

Shigella boydii serotype 4 (strain Sb227)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPSWFFCAIASLILTLITRRIIQRANINLAFVGIIYTALFAVYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Metalloproteinase 3 (MMP-3) ELISA kit
MBS261391-01 48 Well

Porcine Metalloproteinase 3 (MMP-3) ELISA kit

Sign In for Pricing
View Details
Porcine Metalloproteinase 3 (MMP-3) ELISA kit
MBS261391-02 96 Well

Porcine Metalloproteinase 3 (MMP-3) ELISA kit

Sign In for Pricing
View Details
Porcine Metalloproteinase 3 (MMP-3) ELISA kit
MBS261391-03 5x 96 Well

Porcine Metalloproteinase 3 (MMP-3) ELISA kit

Sign In for Pricing
View Details
Porcine Metalloproteinase 3 (MMP-3) ELISA kit
MBS261391-04 10x 96 Well

Porcine Metalloproteinase 3 (MMP-3) ELISA kit

Sign In for Pricing
View Details
pCMV-SPORT6-ACAA2 Plasmid
PVT32061 2 µg

pCMV-SPORT6-ACAA2 Plasmid

Sign In for Pricing
View Details
MTND1P17 ORF Vector (Human) (pORF)
ORF025538 1.0 µg DNA

MTND1P17 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details