Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA)

This Recombinant Shigella boydii serotype 4 Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q31TR5

Expression Region

27-91

Origin

Shigella boydii serotype 4 (strain Sb227)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPSWFFCAIASLILTLITRRIIQRANINLAFVGIIYTALFAVYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bckdha sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
13219116 3x 1.0 µg

Bckdha sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
MED22 (N-term) Rabbit Polyclonal Antibody
E10G31128 100 µL

MED22 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CK-MB 7501 antibody
STJ400199 1 mg

Anti-CK-MB 7501 antibody

Sign In for Pricing
View Details
Speer4d (NM_025759) Mouse Tagged Lenti ORF Clone
MR213561L4 10 µg

Speer4d (NM_025759) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
β-1,4-GalNAc-T4 shRNA (h) Lentiviral Particles
sc-97066-V 200 µL

β-1,4-GalNAc-T4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
AGR2 AAV siRNA Pooled Vector
11537161 1.0 µg

AGR2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details