Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae serotype 2 Uncharacterized membrane protein SPD_2304 (SPD_2304)

This Recombinant Streptococcus pneumoniae serotype 2 Uncharacterized membrane protein SPD_2304 (SPD_2304) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SPD_2304

UniProt

P0C2H1

Expression Region

1-65

Origin

Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKAWLFWSVIVLYFFIKFFDKVLDIKLFGSIQIWLDNLPIPMKILLTIALVLFLFIVFP YRGKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Hormone Receptor Interactor 4 (TRIP4) Antibody
abx213214-01 50 µL

Thyroid Hormone Receptor Interactor 4 (TRIP4) Antibody

Sign In for Pricing
View Details
Thyroid Hormone Receptor Interactor 4 (TRIP4) Antibody
abx213214-02 100 µL

Thyroid Hormone Receptor Interactor 4 (TRIP4) Antibody

Sign In for Pricing
View Details
Picrocrocin (Standard)
HY-N4114R 1 Each

Picrocrocin (Standard)

Sign In for Pricing
View Details
Il12b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7101408 1.0 µg DNA

Il12b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
TKFC Rabbit pAb
E45R21983N-100 100 µL

TKFC Rabbit pAb

Sign In for Pricing
View Details
CDC45 CRISPRa sgRNA lentivector (set of three targets)(Rat)
15631126 3x 1.0µg DNA

CDC45 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details