Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae serotype 2 Uncharacterized membrane protein SPD_2304 (SPD_2304)

This Recombinant Streptococcus pneumoniae serotype 2 Uncharacterized membrane protein SPD_2304 (SPD_2304) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SPD_2304

UniProt

P0C2H1

Expression Region

1-65

Origin

Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKAWLFWSVIVLYFFIKFFDKVLDIKLFGSIQIWLDNLPIPMKILLTIALVLFLFIVFP YRGKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC human CD45 Antibody
orb3066223-01 25 Tests

FITC human CD45 Antibody

Sign In for Pricing
View Details
FITC human CD45 Antibody
orb3066223-02 100 Tests

FITC human CD45 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RAB27B Antibody [mFluor Violet 610 SE]
NBP3-30746MFV610 0.1 mL

Rabbit Polyclonal RAB27B Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) (D26E, L28F), partial
orb3156021-01 20 µg

Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) (D26E, L28F), partial

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) (D26E, L28F), partial
orb3156021-02 100 µg

Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) (D26E, L28F), partial

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) (D26E, L28F), partial
orb3156021-03 1 mg

Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) (D26E, L28F), partial

Sign In for Pricing
View Details