Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae serotype 2 Uncharacterized membrane protein SPD_2304 (SPD_2304)

This Recombinant Streptococcus pneumoniae serotype 2 Uncharacterized membrane protein SPD_2304 (SPD_2304) spans the amino acid sequence from region 1-65.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SPD_2304

UniProt

P0C2H1

Expression Region

1-65

Origin

Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKAWLFWSVIVLYFFIKFFDKVLDIKLFGSIQIWLDNLPIPMKILLTIALVLFLFIVFP YRGKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal metabotropic Glutamate Receptor 5/1 Antibody (S75-3) [Alexa Fluor 700]
NBP2-22424AF700 0.1 mL

Mouse Monoclonal metabotropic Glutamate Receptor 5/1 Antibody (S75-3) [Alexa Fluor 700]

Sign In for Pricing
View Details
FAM55B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0725206 1.0 µg DNA

FAM55B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
1- (2-Fluoro-benzyl) -azetidine-3-carboxylic acid
PC408337-01 100 mg

1- (2-Fluoro-benzyl) -azetidine-3-carboxylic acid

Sign In for Pricing
View Details
1- (2-Fluoro-benzyl) -azetidine-3-carboxylic acid
PC408337-02 250 mg

1- (2-Fluoro-benzyl) -azetidine-3-carboxylic acid

Sign In for Pricing
View Details
Avian Influenza Virus H7 Antibodies ELISA Kit
E-AD-E095-01 96 Tests

Avian Influenza Virus H7 Antibodies ELISA Kit

Sign In for Pricing
View Details
Avian Influenza Virus H7 Antibodies ELISA Kit
E-AD-E095-02 2x 96 Tests

Avian Influenza Virus H7 Antibodies ELISA Kit

Sign In for Pricing
View Details