Recombinant Saccharomyces cerevisiae Cytochrome b-c1 complex subunit 9 (QCR9)
This Recombinant Saccharomyces cerevisiae Cytochrome b-c1 complex subunit 9 (QCR9) spans the amino acid sequence from region 2-66.
Product Specifications
Product Name Alternative
Cytochrome b-c1 complex subunit 9, Complex III subunit 9, Complex III subunit X, Cytochrome c1 non-heme 7.3 kDa protein, Ubiquinol-cytochrome c reductase complex 7.3 kDa protein
UniProt
P22289
Expression Region
2-66
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDG DDDDE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog