Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0A306

Expression Region

1-66

Origin

Streptococcus pneumoniae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Ethyl-4-(1-piperazinyl)thieno[2,3-d]pyrimidine Hydrochloride
TRC-E898795-50MG 50 mg

6-Ethyl-4-(1-piperazinyl)thieno[2,3-d]pyrimidine Hydrochloride

Sign In for Pricing
View Details
Colloidal Gold Conjugated Swine Affinity Purified Antibody to Goat IgG, 1mL 40nm
GAF-014-40 1 mL

Colloidal Gold Conjugated Swine Affinity Purified Antibody to Goat IgG, 1mL 40nm

Sign In for Pricing
View Details
N-Nitroso-N-propyl Urea, Contains 40% Water, ~2% Acetic Acid
TRC-N545750-1G 1 g

N-Nitroso-N-propyl Urea, Contains 40% Water, ~2% Acetic Acid

Sign In for Pricing
View Details
Syntenin Recombinant Rabbit Monoclonal Antibody [JE40-72]
ET7109-14 100 µL

Syntenin Recombinant Rabbit Monoclonal Antibody [JE40-72]

Sign In for Pricing
View Details
Human Syntrophin gamma 2 (SNTG2) activation kit by CRISPRa
GA110078 1 Kit

Human Syntrophin gamma 2 (SNTG2) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human DLL4 Protein (Fc Tag)
PKSH031806-01 50 µg

Recombinant Human DLL4 Protein (Fc Tag)

Sign In for Pricing
View Details