Recombinant ATP synthase subunit c (atpE)
This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
P0A306
Expression Region
1-66
Origin
Streptococcus pneumoniae
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942910-500 1x 500 µL
Prolactin (Pituitary Tumor Marker) (PRL/2910), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471853-500 1x 500 µL
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741992-100 1x 100 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-CL-H0221-01 24 Tests
Human ADAM9 (A Disintegrin And Metalloprotease 9) CLIA Kit
Sign In for Pricing
View Details E-CL-H0221-02 48 Tests
Human ADAM9 (A Disintegrin And Metalloprotease 9) CLIA Kit
Sign In for Pricing
View Details