Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0A306

Expression Region

1-66

Origin

Streptococcus pneumoniae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentadecyltriphenylphosphonium Bromide
TRC-P268210-25MG 25 mg

Pentadecyltriphenylphosphonium Bromide

Sign In for Pricing
View Details
RANBP3L (NM_001161429) Human Over-expression Lysate
LY431433 100 µg

RANBP3L (NM_001161429) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-Cotinine N-Oxide
TRC-C725200-10MG 10 mg

(S)-Cotinine N-Oxide

Sign In for Pricing
View Details
Scopoline
TRC-S201428-500MG 500 mg

Scopoline

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ROMO1 (NM_080748) Human Recombinant Protein
TP310655L 1 mg

ROMO1 (NM_080748) Human Recombinant Protein

Sign In for Pricing
View Details