Recombinant Prochlorococcus marinus Photosystem II reaction center protein H (psbH)
This Recombinant Prochlorococcus marinus Photosystem II reaction center protein H (psbH) spans the amino acid sequence from region 1-66.
Product Specifications
Product Name Alternative
Photosystem II reaction center protein H, PSII-H
UniProt
A3PAX2
Expression Region
1-66
Origin
Prochlorococcus marinus (strain MIT 9301)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGQKTALGSLLKAIGNSGQGKVVPGWGAVPVMTVIGLLLLVFLVILLQIYNQSLLLQGFS VDWNGN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 