Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH)

This Recombinant Synechococcus sp. Photosystem II reaction center protein H (psbH) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Photosystem II reaction center protein H, PSII-H

UniProt

A5GWI2

Expression Region

1-66

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRTRLGDLLRPLNSEYGKVVPGWGTTPVMGIFMALFLVFLLVILQLYNRSLLLDGITV NWNGLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-100 1x 100 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details