Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yrzS (yrzS)

This Recombinant Uncharacterized membrane protein yrzS (yrzS) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yrzS

UniProt

C0H463

Expression Region

1-66

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEFPKIIMILGAVLLIIGAVLHFVGKMPGDIFVKKGNVTFFFPVVTCIIISVVLSILLN LFGRMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM8 Antibody
KC-30831-01 50 μL

TRIM8 Antibody

Sign In for Pricing
View Details
TRIM8 Antibody
KC-30831-02 100 µL

TRIM8 Antibody

Sign In for Pricing
View Details
TRIM8 Antibody
KC-30831-03 1 mL

TRIM8 Antibody

Sign In for Pricing
View Details
RIT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]
TA501703BM 100 µL

RIT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (D33), CF405S conjugate, 0.1mg/mL
BNC041722-500 1x 500 µL

Desmin (Muscle Cell Marker) (D33), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SCYL2 (C-term) Rabbit Polyclonal Antibody
AP13554PU-N 400 µL

SCYL2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details