Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yrzS (yrzS)

This Recombinant Uncharacterized membrane protein yrzS (yrzS) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yrzS

UniProt

C0H463

Expression Region

1-66

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEFPKIIMILGAVLLIIGAVLHFVGKMPGDIFVKKGNVTFFFPVVTCIIISVVLSILLN LFGRMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-20RA/IL-20R1 Protein (His Tag)
PKSH031633 100 µg

Recombinant Human IL-20RA/IL-20R1 Protein (His Tag)

Sign In for Pricing
View Details
ABI2 (NM_005759) Human Over-expression Lysate
LC401755 20 µg

ABI2 (NM_005759) Human Over-expression Lysate

Sign In for Pricing
View Details
GSK360A
TRC-G797600-25MG 25 mg

GSK360A

Sign In for Pricing
View Details
Doxylamine N-Oxide
TRC-D562015-25MG 25 mg

Doxylamine N-Oxide

Sign In for Pricing
View Details
WIPI2 (NM_001033520) Human Over-expression Lysate
LC422379 20 µg

WIPI2 (NM_001033520) Human Over-expression Lysate

Sign In for Pricing
View Details
CAPNS1 Mouse Monoclonal Antibody [Clone ID: AT1D11]
AM50627PU-S 50 µL

CAPNS1 Mouse Monoclonal Antibody [Clone ID: AT1D11]

Sign In for Pricing
View Details