Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yoyD (yoyD)

This Recombinant Uncharacterized membrane protein yoyD (yoyD) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yoyD

UniProt

C0H431

Expression Region

1-66

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKKALIVILILLPFVQLALLPLVNRIEPIMFGLPFFHFWLLLWIIVTPLCSFGIYQMQK KDGGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP2 Antibody, HRP conjugated
CSB-PA339081HB01RJP-01 50 µg

AFP2 Antibody, HRP conjugated

Sign In for Pricing
View Details
AFP2 Antibody, HRP conjugated
CSB-PA339081HB01RJP-02 100 µg

AFP2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Breast (5 slides/pack, single section/slide)
S-HuCAT723 1 unit

Human Breast (5 slides/pack, single section/slide)

Sign In for Pricing
View Details
Diethylene glycol dimethyl ether (Diglyme; Dimethyldigol; 2-Methoxyethyl ether)
104375 500 500 mL

Diethylene glycol dimethyl ether (Diglyme; Dimethyldigol; 2-Methoxyethyl ether)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human PLPPR5 (Phospholipid phosphatase related 5) Full Length
MPC2948K Each

Magic™ Membrane Protein Human PLPPR5 (Phospholipid phosphatase related 5) Full Length

Sign In for Pricing
View Details
Znrd1 (NM_001166300) Rat Tagged ORF Clone
RR215853 10 µg

Znrd1 (NM_001166300) Rat Tagged ORF Clone

Sign In for Pricing
View Details