Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yoyD (yoyD)

This Recombinant Uncharacterized membrane protein yoyD (yoyD) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yoyD

UniProt

C0H431

Expression Region

1-66

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKKALIVILILLPFVQLALLPLVNRIEPIMFGLPFFHFWLLLWIIVTPLCSFGIYQMQK KDGGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin Recombinant Antibody, Cy3 Conjugated
bsm-60266R-Cy3-01 20 µL

Desmin Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Desmin Recombinant Antibody, Cy3 Conjugated
bsm-60266R-Cy3-02 100 µL

Desmin Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
KCNIP4, NT (KCNIP4, CALP, KCHIP4, Kv channel-interacting protein 4, A-type potassium channel modulatory protein 4, Calsenilin-like protein, Potassium channel-interacting protein 4)
037319 200 µL

KCNIP4, NT (KCNIP4, CALP, KCHIP4, Kv channel-interacting protein 4, A-type potassium channel modulatory protein 4, Calsenilin-like protein, Potassium channel-interacting protein 4)

Sign In for Pricing
View Details
Recombinant Phosphofructokinase, Platelet (PFKP)
SIPB459Ra01-01 10 µg

Recombinant Phosphofructokinase, Platelet (PFKP)

Sign In for Pricing
View Details
Recombinant Phosphofructokinase, Platelet (PFKP)
SIPB459Ra01-02 50 µg

Recombinant Phosphofructokinase, Platelet (PFKP)

Sign In for Pricing
View Details
Recombinant Phosphofructokinase, Platelet (PFKP)
SIPB459Ra01-03 200 µg

Recombinant Phosphofructokinase, Platelet (PFKP)

Sign In for Pricing
View Details