Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C1CF99

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain JJA)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neurotrophin-3/NTF3 Protein
PKSH032803-01 10 µg

Recombinant Human Neurotrophin-3/NTF3 Protein

Sign In for Pricing
View Details
Recombinant Human Neurotrophin-3/NTF3 Protein
PKSH032803-02 50 µg

Recombinant Human Neurotrophin-3/NTF3 Protein

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), 1mg/mL
BNUM1707-50 1x 50 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), 1mg/mL

Sign In for Pricing
View Details
m-Tolylacetic acid
TRC-T536580-250MG 250 mg

m-Tolylacetic acid

Sign In for Pricing
View Details
Bromadiolone
TRC-B678200-500MG 500 mg

Bromadiolone

Sign In for Pricing
View Details
PMP22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D1]
TA808964AM 100 µL

PMP22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D1]

Sign In for Pricing
View Details