Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C1CF99

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain JJA)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHAC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]
TA507049BM 100 µL

CHAC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]

Sign In for Pricing
View Details
1,2,3,4,7,7-Hexachloro-5-phenyl-2-norbornene
TRC-H290820-50MG 50 mg

1,2,3,4,7,7-Hexachloro-5-phenyl-2-norbornene

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS649522 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CLCA4 Human Gene Knockout Kit (CRISPR)
KN415626 1 Kit

CLCA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(E)-2-Hydroxy-3,5-dinitro-N'-(2-nitrobenzylidene-d4)benzohydrazide
TRC-H700791-25MG 25 mg

(E)-2-Hydroxy-3,5-dinitro-N'-(2-nitrobenzylidene-d4)benzohydrazide

Sign In for Pricing
View Details
3-Chloro Fenofibric Acid-d6
TRC-C364682-1MG 1 mg

3-Chloro Fenofibric Acid-d6

Sign In for Pricing
View Details