Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C1CF99

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain JJA)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL4 Antibody
KC-17316-01 50 μL

ELAVL4 Antibody

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-17316-02 100 µL

ELAVL4 Antibody

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-17316-03 1 mL

ELAVL4 Antibody

Sign In for Pricing
View Details
LRWD1 Rabbit Polyclonal Antibody
TA371036 100 µL

LRWD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM22 (NM_006074) Human Over-expression Lysate
LY401829 100 µg

TRIM22 (NM_006074) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant CD35 Antibody
RC-15782-01 50 μL

Recombinant CD35 Antibody

Sign In for Pricing
View Details