Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C1CSD4

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain Taiwan19F-14)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUTF2 Polyclonal Antibody
MBS9431903-01 0.05 mL

NUTF2 Polyclonal Antibody

Sign In for Pricing
View Details
NUTF2 Polyclonal Antibody
MBS9431903-02 0.1 mL

NUTF2 Polyclonal Antibody

Sign In for Pricing
View Details
NUTF2 Polyclonal Antibody
MBS9431903-03 5x 0.1 mL

NUTF2 Polyclonal Antibody

Sign In for Pricing
View Details
FAM194B siRNA (h)
sc-75029 10 µM

FAM194B siRNA (h)

Sign In for Pricing
View Details
Olfr78 (NM_001168503) Mouse Tagged ORF Clone
MG215095 10 µg

Olfr78 (NM_001168503) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Troponin-I, Dog Cardiac, pure protein
TNIC33-N-25 25 µg

Troponin-I, Dog Cardiac, pure protein

Sign In for Pricing
View Details