Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C1CSD4

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain Taiwan19F-14)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldh18a1 Mouse shRNA Lentiviral Particle (Locus ID 56454)
TL503197V 500 µL Each

Aldh18a1 Mouse shRNA Lentiviral Particle (Locus ID 56454)

Sign In for Pricing
View Details
Acetyl-d3 L-Carnitine Hydrochloride
sc-480972 10 mg

Acetyl-d3 L-Carnitine Hydrochloride

Sign In for Pricing
View Details
Porcine Contactin Associated Protein 1 ELISA Kit
MBS750094-01 48 Well

Porcine Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Contactin Associated Protein 1 ELISA Kit
MBS750094-02 96 Well

Porcine Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Contactin Associated Protein 1 ELISA Kit
MBS750094-03 5x 96 Well

Porcine Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Contactin Associated Protein 1 ELISA Kit
MBS750094-04 10x 96 Well

Porcine Contactin Associated Protein 1 ELISA Kit

Sign In for Pricing
View Details